PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G274500.2
Common NameB456_008G274500, LOC105765509
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 308aa    MW: 33889.3 Da    PI: 9.7537
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G274500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.4e-1257101147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Gorai.008G274500.2  57 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 101
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1651107IPR009057Homeodomain-like
PROSITE profilePS5129414.1852106IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-655107IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1855104IPR006447Myb domain, plants
SMARTSM007176.5E-1056104IPR001005SANT/Myb domain
PfamPF002494.4E-1057101IPR001005SANT/Myb domain
CDDcd001671.13E-759102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVSKNPNPAE GFYLDPTGMA LPGLGPFAAT DAAASTVSSS EDPNKKIRKP YTITKSRESW  60
TEPEHDKFLE ALQLFDRDWK KIEAFVGSKT VIQIRSHAQK YFLKVQKNGT NEHLPPPRPK  120
RKAAHPYPQK ASKNVHVQPQ ASGSLQSSNA LVDTGCVLRS DPSLMLMNPV TAASSWTHNE  180
QTISFSEAKK GSGMANKSRG SSMSTPQRRQ IGEMTNQGNH GHALRVLPDF VQVYSFIGSV  240
FDPNTTGHLQ KLKKMDPIDI ETVLLLMRNL SINLTSPDFE DHRKLLSSYE IDTETNYHGG  300
ACKAVGT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gra.23161e-157flower|seedling| flowering
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440105.10.0PREDICTED: protein REVEILLE 6-like isoform X2
RefseqXP_012440106.10.0PREDICTED: protein REVEILLE 6-like isoform X2
RefseqXP_012440107.10.0PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotQ8H0W31e-137RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A0D2RNE30.0A0A0D2RNE3_G
STRINGVIT_16s0050g01180.t011e-150(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-122MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]